Protein Info for Rru_A3178 in Rhodospirillum rubrum S1H

Annotation: Holliday junction resolvase YqgF (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF03652: RuvX" amino acids 19 to 150 (132 residues), 127.1 bits, see alignment E=3.1e-41 TIGR00250: putative transcription antitermination factor YqgF" amino acids 20 to 150 (131 residues), 96.6 bits, see alignment E=6.3e-32

Best Hits

Swiss-Prot: 100% identical to YQGF_RHORT: Putative pre-16S rRNA nuclease (Rru_A3178) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K07447, putative holliday junction resolvase [EC: 3.1.-.-] (inferred from 100% identity to rru:Rru_A3178)

Predicted SEED Role

"Putative Holliday junction resolvase YggF"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPH2 at UniProt or InterPro

Protein Sequence (161 amino acids)

>Rru_A3178 Holliday junction resolvase YqgF (NCBI) (Rhodospirillum rubrum S1H)
MPICSLQTFADALPPGRPVLGLDLGTRTIGVATSDVRLTLATPIITIKRRKFTLDVQELF
ALADGRAAAGLVLGLPVEMDGSEGPRCQATRAFARNLLALRDLPVLLWDERLSTAAVNRF
LVGEADMTRARRAEVVDRAAAAYILQGALDALDRQRPEQAF