Protein Info for Rru_A3172 in Rhodospirillum rubrum S1H

Annotation: Lysine exporter protein (LYSE/YGGA) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 67 (29 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 153 to 178 (26 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details PF01810: LysE" amino acids 17 to 209 (193 residues), 111.5 bits, see alignment E=1.9e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3172)

Predicted SEED Role

"Putative threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPH8 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Rru_A3172 Lysine exporter protein (LYSE/YGGA) (NCBI) (Rhodospirillum rubrum S1H)
MIVSPDTLWLFVPAALALNLTPGNDMLFCLGQGMRGGPAAGMAASLGVATGGVVHTLLAA
FGLAALVAAHPGLFAVIRWVGVGYLLWLGLQTLRRPMAPPAFGQAPGGSAGVLRAWREGI
VVNLLNPKVVVFVLAFLPQFVKPEAGPAVPQMLVLGGILSLGGTVVNGVVGALAGGIGRT
LATSGRAREVFRWVSGLVFVGLAARLAFERR