Protein Info for Rru_A3167 in Rhodospirillum rubrum S1H

Annotation: Binding-protein-dependent transport systems inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 283 to 310 (28 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 153 to 360 (208 residues), 122.8 bits, see alignment E=7e-40

Best Hits

KEGG orthology group: K13894, microcin C transport system permease protein (inferred from 100% identity to rru:Rru_A3167)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPI3 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Rru_A3167 Binding-protein-dependent transport systems inner membrane component (NCBI) (Rhodospirillum rubrum S1H)
MIAYILRRLALIPLTLFGIILVNFLIVQIAPGGPVEQVLSRLQGMDGGATARFSGSGGGE
AGGGSATSALGPTTAYRGARGLDPAYVKSLEVQFGFDRPAHERFLKMVGDYLTFDLGQSY
YRSIPVIDLILEKMPVSLSLGIWSTMIIYLVSIPLGIAKAVRDGSRFDMATSWMVVVGYA
VPSFLFAILLIIVFAGGRYFDWFPLRGILSDNWRELSWPQLALDYLWHMVLPVTALVIGG
FASLTMLTKNSFLEEIRKQYVITARAKGLTESKILYRHVFRNAMLLVVAGFPAALVSMLF
TGSVLIEVIFSLDGLGLLGFESTMNRDYPVMFGTLYIFGLIGLLLSLISDATYHIIDPRI
DFESREN