Protein Info for Rru_A3129 in Rhodospirillum rubrum S1H

Annotation: ABC-2 transporter component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 263 to 287 (25 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 355 to 373 (19 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 12 to 318 (307 residues), 52.2 bits, see alignment E=8.4e-18 PF12698: ABC2_membrane_3" amino acids 28 to 370 (343 residues), 174.3 bits, see alignment E=5.9e-55 PF01061: ABC2_membrane" amino acids 183 to 342 (160 residues), 110.8 bits, see alignment E=1.1e-35

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to rru:Rru_A3129)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPM1 at UniProt or InterPro

Protein Sequence (378 amino acids)

>Rru_A3129 ABC-2 transporter component (NCBI) (Rhodospirillum rubrum S1H)
MSRYFSFSRMAAIFFKELIQMRRDRLTFGMMLSVPMLQLILFGFAINTDPKHLATVLNIQ
SPSAFSRDLTAAMSNSGYFDIIGEVSSEAEIDRLLDMGEVQFVLTIPPEFSSELQKGNRP
VVLMEVDATDPAATSNALHVIGQLARTAFDRHLVGPLAPLKVGEDPIDLRIHSRYNPEAN
SQYNVVPGLMGVILTMTMVMMTSLAITRERERDTMETLLSMPVRPLEVMIGKILPYIGLG
YIQIIVVLIAARLLFDVPVVGSLGLLALLLLLFIAANLAIGLTFSALSANQFQAMQMSFF
YFLPALLLSGFMFPFRGMPVWAQVLGEILPLTHFLRVVRGILLKGNGFWQVWPELWPQAL
FTLVAFAIALKVFRKTLD