Protein Info for Rru_A3104 in Rhodospirillum rubrum S1H

Annotation: Two Component, Sigma54 Specific, Transcriptional Regulator, Fis family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 TIGR02915: PEP-CTERM-box response regulator transcription factor" amino acids 8 to 446 (439 residues), 607.7 bits, see alignment E=6.4e-187 PF00072: Response_reg" amino acids 9 to 118 (110 residues), 49.3 bits, see alignment E=1.7e-16 PF00158: Sigma54_activat" amino acids 149 to 315 (167 residues), 245 bits, see alignment E=1.2e-76 PF14532: Sigma54_activ_2" amino acids 150 to 320 (171 residues), 90.6 bits, see alignment E=3.9e-29 PF07728: AAA_5" amino acids 172 to 291 (120 residues), 28.1 bits, see alignment E=6.5e-10 PF00004: AAA" amino acids 173 to 291 (119 residues), 22.5 bits, see alignment E=4.6e-08 PF02954: HTH_8" amino acids 406 to 438 (33 residues), 25.6 bits, see alignment (E = 2.8e-09)

Best Hits

KEGG orthology group: K02481, two-component system, NtrC family, response regulator (inferred from 100% identity to rru:Rru_A3104)

Predicted SEED Role

"Response regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPP6 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Rru_A3104 Two Component, Sigma54 Specific, Transcriptional Regulator, Fis family (NCBI) (Rhodospirillum rubrum S1H)
MTEPLPRLLIVEDDLGVQSQLKWSFSDEWLIDVAADRAKALEIAARTPPTIVILDLGLPP
EPNGAGEGLATLEGLISLNPLTKVIVSSGNEDHRHALSAIRLGAYDFYPKPVDIEHLRLI
TARAAHLRRLEEENRQLARAGHAGPLANVIGESAAIQAVCQMVRRVASTTVNVLLLGESG
TGKEVFAHSLHQLSGRAGQPFVAINCAAIPENLLESELFGHEKGAFTGALRQTTGKIQQA
NGGTLFLDEIGDMPPPLQAKLLRFLQSRVIERVGGRQSLEVDVRIVSATNRDLGALIEKG
EFREDLYYRLDEVKIALPPLRDRIEDAPLLAQYFLDSFAASMGRKVTGFSSDAQVALSAH
PWPGNVRELENRVKRAVVLAEGRLVTAKDMDLVGGAMPTLRESRRRADYQAVTTALLLAG
NNLSLAAKYLGISRPTLYDLIETHNIHV