Protein Info for Rru_A3084 in Rhodospirillum rubrum S1H

Annotation: Small GTP-binding protein domain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 TIGR00231: small GTP-binding protein domain" amino acids 3 to 121 (119 residues), 69.6 bits, see alignment E=4.1e-23 amino acids 232 to 397 (166 residues), 75.3 bits, see alignment E=7.3e-25 PF02421: FeoB_N" amino acids 3 to 61 (59 residues), 41.6 bits, see alignment 5.2e-14 amino acids 234 to 399 (166 residues), 52 bits, see alignment E=3.4e-17 TIGR03594: ribosome-associated GTPase EngA" amino acids 3 to 491 (489 residues), 515.6 bits, see alignment E=1.8e-158 PF01926: MMR_HSR1" amino acids 3 to 119 (117 residues), 98.2 bits, see alignment E=1.8e-31 amino acids 235 to 352 (118 residues), 83.4 bits, see alignment E=6.9e-27 PF00009: GTP_EFTU" amino acids 233 to 402 (170 residues), 46.2 bits, see alignment E=2.3e-15 PF14714: KH_dom-like" amino acids 410 to 491 (82 residues), 103.8 bits, see alignment E=2.7e-33

Best Hits

KEGG orthology group: K03977, GTP-binding protein (inferred from 100% identity to rru:Rru_A3084)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPR6 at UniProt or InterPro

Protein Sequence (500 amino acids)

>Rru_A3084 Small GTP-binding protein domain (NCBI) (Rhodospirillum rubrum S1H)
MFTVAIIGRPNVGKSTLFNRLCGRRLAIVHDMPGVTRDRREGKASLADLVFRVVDTAGLE
EAGPEVLEGRMRQQTDRALSEAHVALMLIDSRAGVTPLDAHFAEILRKAPIPVILVANKC
EGGAGKPGFYESYSMGLGDPVPLSAEHGEGLSLLYEALMPIYDAHMAQEAKDEADAVRAA
FLETEAASAAKPYIDFASLEPDEVPEDDDSDPSQDPEDDFSVEAFDPRGERPIQMAIIGR
PNTGKSTLINRLIGDDRLVTGPEAGVTRDAIEVDWEWGGRRFRLVDTAGLRRKARVENSL
EKLMVADTLNAIRLAEVCVLMLDANMVMDRQDLTIARLVIDEGRALVIAVNKWDACADRK
AALQRLADRLETSLAQVRGVPFVTLSALEGHGLNRLMDAALEAHAKWNRRVPTSRFNRWL
KGMIDRHPLPMGKHGRRLRIRYGTQAKIRPPTFALFMTRPDDLPESYVRYLNSGLREDFD
MAGTPIRLLFRATKNPYADK