Protein Info for Rru_A3077 in Rhodospirillum rubrum S1H
Annotation: Electron transfer flavoprotein beta-subunit (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 70% identical to ETFB_PSEAE: Electron transfer flavoprotein subunit beta (etfB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K03521, electron transfer flavoprotein beta subunit (inferred from 100% identity to rru:Rru_A3077)Predicted SEED Role
"Electron transfer flavoprotein, beta subunit" in subsystem Acetyl-CoA fermentation to Butyrate
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RPS3 at UniProt or InterPro
Protein Sequence (249 amino acids)
>Rru_A3077 Electron transfer flavoprotein beta-subunit (NCBI) (Rhodospirillum rubrum S1H) MKVLVAVKRVVDYNVKIRVKADNTGVELANVKMSMNPFDEIAVEEAIRLKEAGTVTEVVA VSLGVAQCQETLRTALAMGADRGILVQSDVELQPLAVAKMLKALVEKEAPDLILLGKQAI DDDANQTGQMLAALLGWSQGTFLSKLTLAEGKATVTREVDGGLETLSLTLPSVLTADLRL NTPRYASLPNIMKAKKKPIETLSPADLGVDPAPRLTTLKVEEPASRKAGVRVPDVATLVE KLKTEAKVI