Protein Info for Rru_A3075 in Rhodospirillum rubrum S1H

Annotation: permease YjgP/YjgQ (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 57 to 83 (27 residues), see Phobius details amino acids 100 to 125 (26 residues), see Phobius details amino acids 253 to 270 (18 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details amino acids 309 to 331 (23 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details TIGR04408: LPS export ABC transporter permease LptG" amino acids 6 to 362 (357 residues), 255.6 bits, see alignment E=2.6e-80 PF03739: LptF_LptG" amino acids 10 to 358 (349 residues), 204.6 bits, see alignment E=1.2e-64

Best Hits

KEGG orthology group: K11720, lipopolysaccharide export system permease protein (inferred from 100% identity to rru:Rru_A3075)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPS5 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Rru_A3075 permease YjgP/YjgQ (NCBI) (Rhodospirillum rubrum S1H)
MRIYRTLTTYIARTYLTALVGATLVVGALLMLFDVIEITRRSGSKAIGIDVVLEMALYHL
PMSLQSALPFVFMGGAVMIFWKLARSSELVVIRAAGLSVWQFLAPVIAVVVVLGIANVTL
LNPLAAHLYTKYERMDAGMDSGVANPLALSDGGLWLRENNPEGQVVMHAQGVRQVDNALR
MTGVTIFRYGPDRRFESRIDAETAGLREGALVLTSVVTTYPGRVGERAETLEVPSNLTLP
KIQDSFSPPETVSFWELPAFITFFEAAGFSAHAHRLHWHSLIASPLLLIAMVLMGAVFSL
KPSQRSVNWLFRIVGAVAAGFGVFFFSKITYTLGLSQTLPVNLAAWSPALVTTMVALAAL
FHLEDG