Protein Info for Rru_A3055 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF6, transmembrane (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 43 to 63 (21 residues), see Phobius details amino acids 74 to 97 (24 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 164 to 181 (18 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details PF00892: EamA" amino acids 167 to 294 (128 residues), 52.9 bits, see alignment E=2.4e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3055)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPU5 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Rru_A3055 Protein of unknown function DUF6, transmembrane (NCBI) (Rhodospirillum rubrum S1H)
MTVAPCAAASPMKPPLATLSGVAAIVLWSAAVALTRSLSETLGIYGAGAAIYATSGCLVW
LAFGRPRVRGQSALYLWGCGGLFVVYGVSLALALGLAADRRQALDLGLINYLWPSLTLAL
AVPIHRLRVGWWLWPGVIVAFGGVAWATGGGLSLDGLAANIAGNPLAYALALTAAVAWAL
YSNLVRLADPKEGALALFLLASALVMAPMALLEPAPAVVSPATLGELAVMGASTALAYMG
WDVAMKRGDATLVAVLSYFTPLLSVLISALWLDTTPTPSFWMGTGLVVAGSLLCWTASRR
A