Protein Info for Rru_A3034 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF6, transmembrane (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 188 to 190 (3 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details PF00892: EamA" amino acids 14 to 147 (134 residues), 42 bits, see alignment E=5.6e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3034)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPW6 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Rru_A3034 Protein of unknown function DUF6, transmembrane (NCBI) (Rhodospirillum rubrum S1H)
MPQRGKGGLVSCFALVLVVLAAVIHASWNLLSKRAASAGPTFVFAYTFTACLAYAPWALW
LIAQGAVAWSASVVGCLLISGIVHLGYSLCLQRGYQVADLSVVYPVARGTGPLLAVLAAI
VFLGEQPSLRGVFGLIAVVGGIALISTQGRLAAFRKPGGSSGVLWGLATGGLIASYTVVD
AYGVMTLGIAPVVLDWFANGARVVLLAPLIAANPRRAREAMAGKWPLAIGVGLLSPLSYI
LVLAALDIGAPLSIAAPLREMSMMVGALLGMVLLKERVGAWRFGGCAVLLCGVVALGGA