Protein Info for Rru_A3029 in Rhodospirillum rubrum S1H

Annotation: Glucosamine-fructose-6-phosphate aminotransferase, isomerising (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 607 TIGR01135: glutamine-fructose-6-phosphate transaminase (isomerizing)" amino acids 2 to 607 (606 residues), 788.7 bits, see alignment E=1.9e-241 PF13522: GATase_6" amino acids 67 to 191 (125 residues), 67.4 bits, see alignment E=2e-22 PF13537: GATase_7" amino acids 89 to 193 (105 residues), 51 bits, see alignment E=2.1e-17 PF01380: SIS" amino acids 289 to 414 (126 residues), 102.5 bits, see alignment E=2.4e-33 amino acids 460 to 589 (130 residues), 76.6 bits, see alignment E=2.4e-25

Best Hits

Swiss-Prot: 61% identical to GLMS_ZYMMO: Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (glmS) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K00820, glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC: 2.6.1.16] (inferred from 100% identity to rru:Rru_A3029)

Predicted SEED Role

"Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.6.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPX1 at UniProt or InterPro

Protein Sequence (607 amino acids)

>Rru_A3029 Glucosamine-fructose-6-phosphate aminotransferase, isomerising (NCBI) (Rhodospirillum rubrum S1H)
MCGIIGIIGVKDVVPSLMEGLRRLEYRGYDSTGIATLVDGVIDRRRAQGKLGNLEKRLVE
APLAGIIGIGHTRWATHGVPNEVNAHPHASAKVAVVHNGIIENFVALRDRLLAKGHVFAT
ATDTEAVVHLITEYLDEGLSPEEAVGKAIGELEGAFALVILIAGEENLLFAARKGSPLAV
GYGDGEMFLGSDALTLAPLTRRIAYLEDGDWVRVTREGAVFRDVSGAIVERKIHLSSVSG
AMIGKGGHRHYMLKEIYEQPQVIGDTLNAMFNPVERTITLPPLPFALDDVERVTLIACGT
SSYAAMVARYWIESIARVPVDLDVGSEFRYRDPPLQAGGLALFISQSGETADTLAALRHC
KAKGLRCLSIVNVAESTMARESDAVLTTLAGPEIGVASTKAFTTQLVVLACLTIALARAK
GQLDADGEARLSKGLTEVPARAAEILKYDEDLRAIAQTVAEARDVLYLGRGTAFPIALEG
ALKLKEISYIHAEGYAAGEMKHGPIALIDETVPVIVIAPSDGLFDKTASNVQEVVARGGK
VIFLSDSEGNRRLGVTPAFSVVLPAVDPFVAPILYAIPVQLLAYHVAVIKGTDVDQPRNL
AKSVTVE