Protein Info for Rru_A3002 in Rhodospirillum rubrum S1H

Annotation: Nicotinamidase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00857: Isochorismatase
  • amino acids 4 to 200 (197 residues), 108.5 bits, E=2.2e-35

Best Hits

KEGG orthology group: K08281, nicotinamidase/pyrazinamidase [EC: 3.5.1.- 3.5.1.19] (inferred from 100% identity to rru:Rru_A3002)

Predicted SEED Role

"Nicotinamidase (EC 3.5.1.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 3.5.1.19)

MetaCyc Pathways

• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• aldoxime degradation (1/3 steps found)
• NAD salvage (plants) (6/11 steps found)
• superpathway of NAD biosynthesis in eukaryotes (6/14 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.- or 3.5.1.19

Sequence Analysis Tools

See Q2RPZ8 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Rru_A3002 Nicotinamidase (NCBI) (Rhodospirillum rubrum S1H)
MTDALVLIDIQNDFCPGGALAVPEGDRVVAVANRLAPMFGTVILSQDWHPADHRSFVTAH
PGKAAFESVTMDYGPQVLWPPHCVAGTRGAAFVDGLDLGPAHVIVRKGTNRDTDSYSAFQ
ENDKRTSTGLAGLLRERGIERIFLAGLATDFCVCYSALDARALGFEVCLVEDGCRAIDLD
GSLDLARAKMAAAGVKIVTSP