Protein Info for Rru_A2987 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 112 to 132 (21 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 307 to 324 (18 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details TIGR02484: CitB domain protein" amino acids 17 to 383 (367 residues), 581.5 bits, see alignment E=3.7e-179

Best Hits

KEGG orthology group: K13795, citrate/tricarballylate utilization protein (inferred from 100% identity to rru:Rru_A2987)

Predicted SEED Role

"TcuB: works with TcuA to oxidize tricarballylate to cis-aconitate" in subsystem Tricarballylate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ13 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Rru_A2987 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MFDPCDLPPPPAPAPGASAAEAEARRVLALCTVCGYCTGLCDVFRAAERRPALTSGDLGH
LAHLCHGCQACWHACQYTPPHVFAIVVPATLARVRAESYARHAWPRPLKGPAVLALALAA
TLVVPLLTVLLVPSQDLFAANAAPGAFYGVIPWGVMTPIALLTLGWAALAVGLGVARFWR
EGAQGPPAAPLARVWGRALADIVSLRNLKGGGRGCFETDDRPSHRRRWLHHALAGGFLLC
LGSTLAATVYHHGLGREAPYPLTSLPVLLGLVGGCLMVGGASGLAWLKRHADPEPQAAET
LGADRCLLAMLIAVALSGLVLLALRDTAAMGLLLALHLGTVLGFFITLPYGKFVHGAYRA
AALLRSAAERRTDPRAPLAERPGVDRDLP