Protein Info for Rru_A2984 in Rhodospirillum rubrum S1H

Annotation: CrtD protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01946: Thi4" amino acids 4 to 42 (39 residues), 27.5 bits, see alignment 8.3e-10 PF00890: FAD_binding_2" amino acids 5 to 50 (46 residues), 33 bits, see alignment 1.8e-11 PF01266: DAO" amino acids 5 to 492 (488 residues), 37.2 bits, see alignment E=1.1e-12 PF00070: Pyr_redox" amino acids 5 to 39 (35 residues), 23.8 bits, see alignment 2.4e-08 TIGR02734: phytoene desaturase" amino acids 6 to 500 (495 residues), 267.1 bits, see alignment E=1.5e-83 PF12831: FAD_oxidored" amino acids 6 to 48 (43 residues), 31.1 bits, see alignment 7.1e-11 PF13450: NAD_binding_8" amino acids 8 to 61 (54 residues), 52.3 bits, see alignment 2.6e-17 PF01593: Amino_oxidase" amino acids 13 to 298 (286 residues), 73.4 bits, see alignment E=1.1e-23 amino acids 452 to 495 (44 residues), 19.9 bits, see alignment 1.8e-07

Best Hits

Swiss-Prot: 54% identical to CRTD_RUBGE: Hydroxyneurosporene desaturase (crtD) from Rubrivivax gelatinosus

KEGG orthology group: K09845, methoxyneurosporene dehydrogenase [EC: 1.14.99.-] (inferred from 100% identity to rru:Rru_A2984)

MetaCyc: 54% identical to 1'-hydroxy-gamma-carotene C-4' ketolase (Candidatus Thiodictyon syntrophicum Cad16)
RXN-16056

Predicted SEED Role

"Methoxyneurosporene dehydrogenase (EC 1.14.99.-)" in subsystem Carotenoids (EC 1.14.99.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.99.-

Use Curated BLAST to search for 1.14.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ16 at UniProt or InterPro

Protein Sequence (503 amino acids)

>Rru_A2984 CrtD protein (NCBI) (Rhodospirillum rubrum S1H)
MKTQHVVVVGAGMGGLAAAIDLASRGLRVTVLERSPSPGGKMREIAVGGARLDAGPTVFT
MRWVFEELFADAGASLGESLRLRAAEVLARHTWGDGAPFDLFADAARSTEAVGELAGAAE
AKRFVAFCARARGIWQALEGPFIRGQRPSPGELVRRSGLSGLSGLARISPFTLLWKALGE
HFHDPRLRQLFGRYATYCGSSPFLAPATLMLVAHVEQQGVWMVDGGMHQIARAMADLATA
KGATFRYSTTAESVLVENGKVGGLILQGGERLAADIVLINGDAAALAARCFGPQVAAAVP
PVPPTARSLSAVTWGLLAEAEGFPLLRHSVFFGNDYPGEFRDIFTHGRLPSSPTVYVCAQ
DRGDKAPTVGPSGPRPERLLVLVNAPARGDLSFPDAMELDTCTARTFAFLERCGLTLRRT
PEATRVTTPADFNSLFPATGGALYGRASHGWSATFDRPGAKTAMPGLYLAGGSVHPGPGV
PMAALSGRLAAQAVLADLTSRGR