Protein Info for Rru_A2982 in Rhodospirillum rubrum S1H

Annotation: O-methyltransferase, family 2 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 114 to 133 (20 residues), see Phobius details PF08100: Dimerisation" amino acids 45 to 124 (80 residues), 41.8 bits, see alignment E=1.2e-14 PF00891: Methyltransf_2" amino acids 179 to 355 (177 residues), 136.4 bits, see alignment E=1.3e-43 PF13489: Methyltransf_23" amino acids 191 to 357 (167 residues), 33.9 bits, see alignment E=4e-12

Best Hits

KEGG orthology group: K09846, hydroxyneurosporene methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to rru:Rru_A2982)

MetaCyc: 55% identical to 1'-hydroxy-1',2'-dihydro-beta,psi-caroten-4'-one O-methyltransferase (Candidatus Thiodictyon syntrophicum Cad16)
2.1.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ18 at UniProt or InterPro

Protein Sequence (396 amino acids)

>Rru_A2982 O-methyltransferase, family 2 (NCBI) (Rhodospirillum rubrum S1H)
MKTLSSHAVSDALTGWRDRLLTNDRFQYWAMRLPGLRTIARRRARSLFDLCAGFVYSQVL
DACVRLDLLPVLAEGPQTATVVAERIALPVEGARRLLEAAVSLDLVERRRGGRFGLGALG
AAMLGNPAVLAMVRHHGLFYQDMRDPVALLRGEAGETALSRYWAYARSQAPDELAEPAVS
DYSALMSASQALVADEILDAVPLGNARCLMDIGGGEGGFMAAVLGRYPKIRGIVFDLQSV
ADRAADRLDAAGFEPRVRVAGGDFRVDPLPTESDVMTLVRVVHDHDDDTVRALLAAAHRA
LPDSGLLIVAEPMADTPGAEPMGAAYFGFYLLAMGSGRPRSRATLTEMLREAGFADVRMA
KTRNPLLTQVLVARKAAPASLAAVGAKVPQAAGDCK