Protein Info for Rru_A2981 in Rhodospirillum rubrum S1H

Annotation: 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 TIGR01202: chlorophyll synthesis pathway protein BchC" amino acids 3 to 312 (310 residues), 437.9 bits, see alignment E=9.2e-136 PF08240: ADH_N" amino acids 26 to 124 (99 residues), 45.2 bits, see alignment E=5.1e-16

Best Hits

Swiss-Prot: 56% identical to BCHC_RHOCB: 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase (bchC) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K11337, 3-hydroxyethyl bacteriochlorophyllide a dehydrogenase [EC: 1.-.-.-] (inferred from 100% identity to rru:Rru_A2981)

MetaCyc: 69% identical to bacteriochlorophyllide a dehydrogenase (Blastochloris viridis)
RXN-17479 [EC: 1.1.1.396]

Predicted SEED Role

"2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase BchC" in subsystem Chlorophyll Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.1.1.396

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ19 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Rru_A2981 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide (NCBI) (Rhodospirillum rubrum S1H)
MDTLAVVIQEPERLTLSRLDLTDPAPGDVVVDVEWSGISTGTERLLWSGRMPPFPGMGYP
LVPGYESVGRVIAVGSQARAKVGTQVGDRVFVPGARCYGAVNGLFGGAASRVVVPADRVV
ALPEGLDDKGVLLALTATAYHAMVIAGDLRPELIVGHGVLGRLLARLVVGVGGTAPTVWE
RNPQRRSGAIGYAVVDPAEDPRKDYRCICDVSGDATILDTLVARLARGGEIVLAGFYESA
LSFTFPPAFMREARIRVAAEWRPEDLAAVIDMIVDGRMSLDGLITHREEAPQAASAYRTA
FTDPSCLKMVLDWRACS