Protein Info for Rru_A2979 in Rhodospirillum rubrum S1H

Annotation: Chlorophyllide reductase subunit Y (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 70 to 90 (21 residues), see Phobius details TIGR02015: chlorophyllide reductase subunit Y" amino acids 41 to 461 (421 residues), 696.8 bits, see alignment E=4.9e-214 PF00148: Oxidored_nitro" amino acids 54 to 445 (392 residues), 160.9 bits, see alignment E=2.3e-51

Best Hits

Swiss-Prot: 73% identical to BCHY_RHOS4: Chlorophyllide reductase 52.5 kDa chain (bchY) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K11334, chlorophyllide reductase subunit Y (inferred from 100% identity to rru:Rru_A2979)

MetaCyc: 73% identical to chlorophyllide a reductase Y subunit (Cereibacter sphaeroides)
RXN-17425 [EC: 1.3.7.15]; 1.3.7.15 [EC: 1.3.7.15]; 1.3.7.15 [EC: 1.3.7.15]

Predicted SEED Role

"Chlorophyllide reductase subunit BchY (EC 1.18.-.-)" in subsystem Chlorophyll Biosynthesis (EC 1.18.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.-.-

Use Curated BLAST to search for 1.18.-.- or 1.3.7.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ21 at UniProt or InterPro

Protein Sequence (468 amino acids)

>Rru_A2979 Chlorophyllide reductase subunit Y (NCBI) (Rhodospirillum rubrum S1H)
MTELPAEAAQVVAGCHVGSDAMRRSAEVAGNGAVLARYAADYPAGPHDQPQSMCPAFGSL
RVGLRMRRTATVLSGSACCVYGLTFVSHFYGAKRSVAYVPFSSETLVTGKLFEDIRDAVE
DLADPALYDAVVVTNLCVPTASGVPLRLLPKAINGVRIIGIDVPGFGVPTHAEAKDILSG
AMLAYARGEAEQGPVQAPRGGPASRPTITLLGEMFPADPMGIGAMLDPLGLAVGPVVPVG
EWRQLYAALDCAAVAAIHPFYTASLREFAAAGRTAVGSAPVGRDGTAAWLAAIGEACGIA
AAKVATAQNRFLPLIGEALAKAPIRGRITLSGYEGSELIVARVLVESGADVAYVGTACPR
TPWSEDDRAWLEARGVPVKFRASLEDDLAAVDALAPDLAIGTTPVVQHAKQKAIPALYFT
NLISARPLMGPAGAGSLAQVINAALANKARFETMRAFFEGPAEGEGGR