Protein Info for Rru_A2978 in Rhodospirillum rubrum S1H

Annotation: Chlorophyllide reductase subunit Z (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 TIGR02014: chlorophyllide reductase subunit Z" amino acids 2 to 470 (469 residues), 903.1 bits, see alignment E=2e-276 PF00148: Oxidored_nitro" amino acids 12 to 392 (381 residues), 120.8 bits, see alignment E=6.7e-39

Best Hits

Swiss-Prot: 75% identical to BCHZ_RUBGI: Chlorophyllide reductase subunit Z (bchZ) from Rubrivivax gelatinosus (strain NBRC 100245 / IL144)

KEGG orthology group: K11335, chlorophyllide reductase subunit Z (inferred from 100% identity to rru:Rru_A2978)

MetaCyc: 74% identical to chlorophyllide reductase subunit BchZ (Blastochloris viridis)
RXN-17477 [EC: 1.3.7.14]

Predicted SEED Role

"Chlorophyllide reductase subunit BchZ (EC 1.18.-.-)" in subsystem Chlorophyll Biosynthesis (EC 1.18.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.-.-

Use Curated BLAST to search for 1.18.-.- or 1.3.7.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ22 at UniProt or InterPro

Protein Sequence (480 amino acids)

>Rru_A2978 Chlorophyllide reductase subunit Z (NCBI) (Rhodospirillum rubrum S1H)
MMLLDHDRAGGYWGAVYVFGALKGLQVVIDGPVGCENLPVTAVLHYTDALPPHELPIVVT
GLGESELGRDGTEAAMTRAHATLDPSRPAVVVTGSIAEMIGGGVTPAGTGLKRFLPRTID
EDQWQSADRALRWLWSEFGAGKRTKTPARPAEAKPRVNIIGPSYGMFNMWSDIAEIRRLV
EGIGAEIALEFPLGSHLDDVPRLAEADVNICLYREFGRGLCEALGKPYLQAPIGLHSTTA
FLRTLGQLLGLDPEPFIEREKQTTIKPLWDLWRSVTQDFFGTASFGIAANETYSRGVRHF
LEEEMGLPCRFSFARKAGSKTDNQAIRQAIKDTPPLVLFGSFNERMYLAEANGRGAYVPA
SFPGAIIRRHTGTPFMGYSGATYLVQEVCNALFDMLFNILPMARDLDAVEATPSRMHDEL
PWDDEARAVLDRTVEAQPVVARISAAKRLRDAAERSARAAGEGQVTAARVIRLLDLQAGA