Protein Info for Rru_A2973 in Rhodospirillum rubrum S1H

Annotation: Peptidase M16-like (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF05193: Peptidase_M16_C" amino acids 189 to 364 (176 residues), 118.8 bits, see alignment E=1.3e-38

Best Hits

Swiss-Prot: 41% identical to Y4WB_SINFN: Uncharacterized zinc protease-like protein y4wB (NGR_a01030) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K01412, mitochondrial processing peptidase [EC: 3.4.24.64] (inferred from 100% identity to rru:Rru_A2973)

Predicted SEED Role

"ZINC PROTEASE (EC 3.4.99.-)" (EC 3.4.99.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.64, 3.4.99.-

Use Curated BLAST to search for 3.4.24.64 or 3.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ27 at UniProt or InterPro

Protein Sequence (447 amino acids)

>Rru_A2973 Peptidase M16-like (NCBI) (Rhodospirillum rubrum S1H)
MKRLLFALVLLVAPWGAFSAQATPVQTVTTPSGVTAYLLADPTLPIVSLSFILPGGAVSD
PADRRGLATLASGLLDEGAGPYDSQAFRARLEDQAIELRFDAGRDSFSGSLKTTTATLED
AFALLRLALHEPRFDAEPVDRIRAQVMTAVRMGEADPQTLASKALFAAVFADSPYAFDEQ
GSEEGLRAITADDLRGFVRRQLVRQGLAIGVAGDITPEHLSALLERTFGDLPATGDQPPL
PVPTPRLAGTTTVIDRDIPQSIALLAQGGLKREDADWQAAYVLNYILGGGGFNSRLMNEV
REKRGLAYSVYSTLYPFRTVGLWLAGTATQNARLGESLAVMRAEWARMAESGPTDQELAD
AKTYLTGAWPLRFTSTEAVAAILASMRMTDLPADYIDRRNAEILALTTDDLRRVAKRLMT
PDQLTAVVVGRPEGLPPAADPTAPAVR