Protein Info for Rru_A2967 in Rhodospirillum rubrum S1H

Annotation: Peptidase A8, signal peptidase II (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 48% identical to LSPA_AZOSB: Lipoprotein signal peptidase (lspA) from Azoarcus sp. (strain BH72)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 100% identity to rru:Rru_A2967)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ33 at UniProt or InterPro

Protein Sequence (160 amino acids)

>Rru_A2967 Peptidase A8, signal peptidase II (NCBI) (Rhodospirillum rubrum S1H)
MAPALSLAALVIALDQATKWAILTWVMDPPRVIDVTGFFNLVLVWNRGISFGVMNNHGEW
NAAILSALALVIAGSLTWWLRRAETRWQRLALPLIIGGAIGNVIDRLIHGAVVDFVDLSI
AGYHWPAFNVADAAITVGAILLLIDTLVHRPPVGTDKAGG