Protein Info for Rru_A2946 in Rhodospirillum rubrum S1H

Annotation: DNA mismatch repair protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 TIGR00585: DNA mismatch repair protein MutL" amino acids 1 to 310 (310 residues), 296 bits, see alignment E=2.3e-92 PF02518: HATPase_c" amino acids 22 to 77 (56 residues), 32.6 bits, see alignment 1.9e-11 PF13589: HATPase_c_3" amino acids 24 to 116 (93 residues), 43.8 bits, see alignment E=5.4e-15 PF01119: DNA_mis_repair" amino acids 214 to 329 (116 residues), 120 bits, see alignment E=9.2e-39 PF08676: MutL_C" amino acids 444 to 586 (143 residues), 158.1 bits, see alignment E=2.4e-50

Best Hits

Swiss-Prot: 100% identical to MUTL_RHORT: DNA mismatch repair protein MutL (mutL) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03572, DNA mismatch repair protein MutL (inferred from 100% identity to rru:Rru_A2946)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ52 at UniProt or InterPro

Protein Sequence (629 amino acids)

>Rru_A2946 DNA mismatch repair protein (NCBI) (Rhodospirillum rubrum S1H)
MTIRLLPPVLVNRIAAGEVVERPASAVKELVENAIDAGASRIDITMTDGGRARILVVDDG
RGMDPGELSLAVERHATSKLPGDDLLDIHTLGFRGEALPSIGSVARLTLTSRAAGAGDAW
ALTVEGGAKGEPEPASHPQGTRVEVRDLFYATPARLKFLKAPRTEQMHAVDVVHRLAMAH
PAVGFTLSDGTRQQIRLSGAQGELFEARLTRLGAILGREFSDNAIAIEAEREGIRLTGHA
ALPTYNKATSAGQYLFVNGRPVRDKLLHGAVRGAYQDVLAHDRNAVLALYLDLPPEMVDV
NVHPAKAEVRFRDPGLVRGLIIGALRHALAAAGHRASSTVSLAALGALRPAQGSGAPALP
WGAGGYGGGASHPGLEERRSAYAAQAPAGTPDPWAGRGMGAGGGSGQAAMAWLAGAPPAA
PRLAGEPEAPPTGAEDFPLGAARGQIHDTYIIAQTRDGVVIVDQHAAHERLVMERMKAAL
AERGEVARQILLLPEVVELDEPGAVRVATAAAELAKLGLVVEGFGPGAVVVREVPALLGD
TDVKGLVADLAEGLAEWGTAQALEDRLGDVVATMACHGSVRAGRRLRIEEMNALLRDMER
TPRAGQCNHGRPTYVELRLGDIERLFGRR