Protein Info for Rru_A2927 in Rhodospirillum rubrum S1H

Annotation: Acriflavin resistance protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1009 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 334 to 353 (20 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 386 to 405 (20 residues), see Phobius details amino acids 426 to 449 (24 residues), see Phobius details amino acids 459 to 481 (23 residues), see Phobius details amino acids 522 to 544 (23 residues), see Phobius details amino acids 836 to 857 (22 residues), see Phobius details amino acids 868 to 886 (19 residues), see Phobius details amino acids 893 to 916 (24 residues), see Phobius details amino acids 937 to 960 (24 residues), see Phobius details amino acids 967 to 991 (25 residues), see Phobius details PF00873: ACR_tran" amino acids 6 to 994 (989 residues), 744.4 bits, see alignment E=9.9e-228

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2927)

Predicted SEED Role

"RND multidrug efflux transporter; Acriflavin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ71 at UniProt or InterPro

Protein Sequence (1009 amino acids)

>Rru_A2927 Acriflavin resistance protein (NCBI) (Rhodospirillum rubrum S1H)
MSMPISTWAIRNPIPPIVLFLALTIAGLIAFTKLPVTSMPSVIVPVVSVTISQPGASPTE
IESQITRRVEGALAGLRGVKHITSTISEGTSLSTVEFHLETDFDRAMSDTRDAITNIRDQ
LPRSILEPQVQRVEIDGGALLAFSVEAPEMRAEDLAWFIDDTVSRNLLAVPGVASVRRQG
GVVHEITVTLDPAKLAAFSVTAAEISRQLALTTIDLPGGRLIEGEREYSLRTLGGAQSAS
ALRDIWIGLGSGRGVRLGDIAEVTDGGAEARSITRLDGKPVVTFAVFRAKGASEITVGES
VKRALEDSQAADPFVTYKEIFSLVDFTQTSYQSTLYVFFEGAILTILTVFLFLRDRRATA
LAALTIPLSIIPTFLVLYFLGFSLNFVSLMAISLVTGVLVDDAIVEIENIHRHMAQAKGP
YDAAMIAADEIGLAVVATTAVICAVFMPVSFMGGAAGKFFIQFGVTVSVAAFFSLMVARL
LTPMIAAYGLKAPAHRDDKPGLWGLRYRHLVVWTLDNRGKTLGIAALSVVLSFGLVPYLS
TGYLPYEDYAQSSMTIELPRGATLEQTDAVALRVVDILKKHPEVMYVLTSAGGETGVNTA
TVEIKLLPLKARNVSQRGFESQVLSELTDLPDVRIKFANSGGSKDISIALTGENAAALDA
AARAIERDMRGIAGLIAVGSTAPSEQPEIVILPDFAKAAQLGVTVQALSDAVNIATIGDI
DTNLAKLNHDGRQFAIRVRLASGPTTTLDTIGELRIPTSEGGSVPLSALAEIRFGSGPAS
IERYDRRRKIAVEANLVDLSLGDALQLISDLPSMKALPKGIEALNTGDVEEMTDLFSRFL
TAIGAGLMMVYAIQVLLYKDWIQPFTRMAALPLSIGGAFLALVLTNTDLNMPAAIGILML
MGIADKNSILLVDYMVERIRQGVPRREAIIESCAVRARPIIMTSLAMLAGMVPIVLGIGL
DTAFRAPMAVAVIGGLISSTALSLVFVPVLFDCVRDFEDWLLPKLRRLA