Protein Info for Rru_A2908 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF140 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 148 to 202 (55 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details PF02405: MlaE" amino acids 61 to 271 (211 residues), 225.9 bits, see alignment E=2.3e-71

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to rru:Rru_A2908)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQ90 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Rru_A2908 Protein of unknown function DUF140 (NCBI) (Rhodospirillum rubrum S1H)
MDSPKTKPGLSQALLKAVERLGQGVIAGVAEIGQASLLGAESLYWLVVGRFRGQPVRLGA
IVEQAMEMGIRALPIVLVMNFTIGMMLAIQGIYSLRMFGAEQQVVLGVAFSVVREFAPLI
TGILVAGRSGSAIAARLGTMTINQEIDALTVMGIVPVRYLVAPPLIAALVMVPLMTFLGM
LVALLGASLTVRIDLGMSLSAFFHQTLDILRLIDLTHGLGKSALFALQIVLVGVVNGVSV
SGGAEGVGKMTTRSVVQAISAIIVTDMVFAFILTR