Protein Info for Rru_A2892 in Rhodospirillum rubrum S1H

Annotation: ABC-3 transporter component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 61 to 86 (26 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details PF00950: ABC-3" amino acids 16 to 269 (254 residues), 250.7 bits, see alignment E=8.5e-79

Best Hits

Swiss-Prot: 53% identical to YFED_YERPE: Chelated iron transport system membrane protein YfeD (yfeD) from Yersinia pestis

KEGG orthology group: K11606, manganese/iron transport system permease protein (inferred from 100% identity to rru:Rru_A2892)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitD" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQA6 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Rru_A2892 ABC-3 transporter component (NCBI) (Rhodospirillum rubrum S1H)
MTGSWLETLLLPFTVPFLRDAMIIALLVAVPTALLSCFLVLKGWALMGDAISHAVLPGVV
LAYVAGLPLGVGAFAAGLGCALVTGYLKDNSRIKQDTVMGVVFSGMFGLGIVLHTSIRTD
VHLDHILFGDMLGVGSSDLLESGLIALLVVGAIALKGRDLLLHAFDPQQARAIGLPVGLL
HYGLLCLLALTIVGALKATGILLTVALLIGPGAIAFLFTRRFSSMLLAAVVISSLASVLG
VYISLFLDSAPAPTIVLLLTLTFIAAFMVSRQRDRQRARGVDRPV