Protein Info for Rru_A2866 in Rhodospirillum rubrum S1H

Annotation: Ribosomal protein L11 methyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF06325: PrmA" amino acids 49 to 294 (246 residues), 158.4 bits, see alignment E=7.3e-50 PF05175: MTS" amino acids 149 to 234 (86 residues), 36.2 bits, see alignment E=1.2e-12 PF13847: Methyltransf_31" amino acids 160 to 234 (75 residues), 28.2 bits, see alignment E=3.8e-10 PF13649: Methyltransf_25" amino acids 161 to 234 (74 residues), 30.4 bits, see alignment E=1.3e-10 PF08241: Methyltransf_11" amino acids 162 to 217 (56 residues), 21.9 bits, see alignment E=5.5e-08

Best Hits

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to rru:Rru_A2866)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQD2 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Rru_A2866 Ribosomal protein L11 methyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MPSTPGAPPSFWQVEITVPEVVVAPLEGALDEISVALLCFEVDEAHHIWKIQALCEDKPD
PAFLAATLALVSTVAGIEEPSFEVIRLEGRDWLRENLITFPPISVGRFFVHGSHHKAKLP
AGRWPLTVDAATAFGSGDHDSTRGCLTAINLLAKRHRYRNILDMGCGSGILSLAAARAFA
RPVRAVDIDVESVRVARFNAHLNGLAAFIRAEHGNGARGRTVIEGGPYDLILANILARPL
CGLARPLAGLLAPKGKVVLAGLLDWQEAQVLSAYRSQGLRLVHRIAFRPWTTLILGR