Protein Info for Rru_A2859 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 784 PF13432: TPR_16" amino acids 59 to 118 (60 residues), 16.7 bits, see alignment 4.7e-06 amino acids 93 to 155 (63 residues), 26.3 bits, see alignment 4.5e-09 amino acids 161 to 218 (58 residues), 32.9 bits, see alignment 3.9e-11 PF07719: TPR_2" amino acids 126 to 155 (30 residues), 23.8 bits, see alignment (E = 1.8e-08) PF13181: TPR_8" amino acids 127 to 150 (24 residues), 15.2 bits, see alignment (E = 1.1e-05) PF13176: TPR_7" amino acids 129 to 156 (28 residues), 15.4 bits, see alignment (E = 8.7e-06) PF13844: Glyco_transf_41" amino acids 598 to 733 (136 residues), 53.1 bits, see alignment E=9.8e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2859)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQD9 at UniProt or InterPro

Protein Sequence (784 amino acids)

>Rru_A2859 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MSQNAPPPLPVSPPLPVAARAAFLWCLRLDEGGDRPGALEACRNALALAPDHPDLLAAQG
AIALAENDASQARAAFDHLAATTPADARGWHGLGRVHLALGEPADALLALDRATERAQAP
LAGLAHDRALALRQLGRFDEALATLERALEHSPGDCALLTQKARVLERARRPRDAAEVAG
QVLARHPDDATAQAVLADALLTLGRPGEALAPARALLDRLLAPPAAATPEALLDALERVG
RCLRVLGRHGVWVEDSRRVCARLPDHPDALSALATALWWSGDFPGALVPLRRALVLDPSH
PTALWQSMLYPLQPVYATEAARAEALAEHRRAARDLARLPPERLSSVDPLLIGYPFYAPY
HGPLDLDAQRRIGATLCAAQADWAARHPVAASSPAHSGPRGDDRKRVAFVSAFFRAHTVC
KLFKAWIEDLDRDRFHVSVLHLDERADEETAAIAALADRFHHLPRGGMAARAVLGDLAPH
AIVYPELGMNNDTLRLAALRLAPVQAVAWGHPASSGLPTLDLFLSSDLMEPEGGEAAYSE
RLVRLPGLSIRYSPAFSVDDREQARRETRAALGLDEATPLLLSLQTHPKYAPADDALLAA
IAARLPEARFALIDSRFPIPGTILRQRLDDAFRAQGVDPEGRILMRPPMPLEAYRRLNLA
GDLFLDTPAWSGGNTTFEAIHCGLPILTLPGTTLWARHSAAILTALGIDETIARDREDYV
DLAERLIRDPAWRVGLVKRATAAKNALFTDRRPGAALSDVLCDAIDRASSSSPLAKDAPW
PTAR