Protein Info for Rru_A2830 in Rhodospirillum rubrum S1H

Annotation: Flagellar transport protein FliP (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details transmembrane" amino acids 66 to 93 (28 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 203 to 227 (25 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details PF00813: FliP" amino acids 66 to 257 (192 residues), 267.9 bits, see alignment E=2.9e-84 TIGR01103: flagellar biosynthetic protein FliP" amino acids 66 to 261 (196 residues), 288.5 bits, see alignment E=1.3e-90

Best Hits

Swiss-Prot: 58% identical to FLIP_CAUVC: Flagellar biosynthetic protein FliP (fliP) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 100% identity to rru:Rru_A2830)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQG8 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Rru_A2830 Flagellar transport protein FliP (NCBI) (Rhodospirillum rubrum S1H)
MTALSQPGTPPNRWAWMRRGALALGLGLGLCLLSSLAGEAMAQSVNVDLGTGGGSTTARI
IQLVGLLTVLSVAPGLLIMVTSFTRIVVVLSILRQALATQSTPPNMVMVSLALFMTFFIM
APTFQQAWDQGLSPLIQEQISEEEAFTRTVAPFRTFMLAHVRDKDLELFMSFNKETAAQP
SDVSTQALIPAFMISELRRAFEIGFLIFLPFVVIDMVIASVLMSMGMMMLPPMMLAMPFK
LIFFVLVDGWYLVIGSLLSSYGTS