Protein Info for Rru_A2822 in Rhodospirillum rubrum S1H

Annotation: Flagellar biosynthesis protein FliR (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 122 to 145 (24 residues), see Phobius details amino acids 181 to 183 (3 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 213 to 240 (28 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 11 to 246 (236 residues), 183.7 bits, see alignment E=2.3e-58 PF01311: Bac_export_1" amino acids 11 to 244 (234 residues), 202.2 bits, see alignment E=4.7e-64

Best Hits

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 100% identity to rru:Rru_A2822)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQH6 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Rru_A2822 Flagellar biosynthesis protein FliR (NCBI) (Rhodospirillum rubrum S1H)
MLDAFLNQNLFHFLLVFVRLGTAMLVLPGLSSTYVSVNIRILLAVTITLVALPTVGAALP
PAPDNTAFLVLLIAVEATIGVFLGMMAQFLLVPVSFAGNIMGFSTGLMMAQAFDPTTAQQ
SALIAGFLGEVAMVMVFVTGMHHLMIEAVVNSYDAFPPGQMPDTGDMVQLLVTILSSGFR
LGLQLAAPFIIYAIIFNATLGVIARLMPQLNVLFVAMPAQILFGLALLMTTVPFLIYSFL
GHFERGLINLAMP