Protein Info for Rru_A2819 in Rhodospirillum rubrum S1H

Annotation: RecA DNA recombination protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR02012: protein RecA" amino acids 15 to 335 (321 residues), 581.9 bits, see alignment E=1.8e-179 PF00154: RecA" amino acids 18 to 280 (263 residues), 485.1 bits, see alignment E=1.1e-149 PF08423: Rad51" amino acids 49 to 238 (190 residues), 36.7 bits, see alignment E=6e-13 PF06745: ATPase" amino acids 52 to 123 (72 residues), 30.7 bits, see alignment E=4.2e-11 PF21096: RecA_C" amino acids 283 to 338 (56 residues), 93.3 bits, see alignment E=1.6e-30

Best Hits

Swiss-Prot: 100% identical to RECA_RHORT: Protein RecA (recA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03553, recombination protein RecA (inferred from 100% identity to rru:Rru_A2819)

MetaCyc: 73% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQH9 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Rru_A2819 RecA DNA recombination protein (NCBI) (Rhodospirillum rubrum S1H)
MSQSVLRLVDKDTMDKQKALEAAVGQIERAFGKGSIMKLGQRGSVVDIESISTGSLGLDI
ALGIGGLPRGRIVEIYGPESSGKTTLALHVVAEAQKKGGQCAFVDAEHAFDPLYARKLGV
SLDDLLVSQPDTGEQALEIADTLVRSGAIDVLVIDSVAALVPKAELEGDMGDSHVGLQAR
LMSQALRKLTGTVSRSNTLIIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIG
AVKDKEEVVGNQTRVKVVKNKVAPPFKVVEFDIMYGEGISKLGEMLDLGVKANIIEKSGA
WFSYNSTRIGQGRENAKQFLRDNPAMAEEIENAVRANAGLIAEEMIGGPGGEDDDAGGAA
GVGDEA