Protein Info for Rru_A2809 in Rhodospirillum rubrum S1H

Annotation: Iron permease FTR1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 660 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details transmembrane" amino acids 398 to 424 (27 residues), see Phobius details amino acids 436 to 458 (23 residues), see Phobius details amino acids 470 to 488 (19 residues), see Phobius details amino acids 508 to 525 (18 residues), see Phobius details amino acids 546 to 568 (23 residues), see Phobius details amino acids 579 to 597 (19 residues), see Phobius details amino acids 629 to 649 (21 residues), see Phobius details PF03239: FTR1" amino acids 317 to 523 (207 residues), 88 bits, see alignment E=3.5e-29 amino acids 514 to 605 (92 residues), 25.9 bits, see alignment E=3e-10

Best Hits

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 100% identity to rru:Rru_A2809)

Predicted SEED Role

"High-affinity Fe2+/Pb2+ permease precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQI9 at UniProt or InterPro

Protein Sequence (660 amino acids)

>Rru_A2809 Iron permease FTR1 (NCBI) (Rhodospirillum rubrum S1H)
MFMDNRAVGVWGLGVLKGVSLWTARVAVVVFVWAAGLGPALADPDYKGMVDRIDAFLSGA
AESYRAGDAETAKTNVQRAYFEVFENLEGPIRVNISAKASYALEAEFGAIRKLVMAGAPP
EEVAARTTAQIAAIRAVVPVLEAGFKIKAHPAAGAEDEAAPNPTPALPQTIEPYWQRAVE
AIGTDLYAAASALEAGKPDEAKALITRAQFSGYKNSLLETAVRRTLSQRQDIAFNAEFQR
ILGLVDAGKPPRMIRASADVLVEELTALLPGLPLVGIAKDQAAPAAEPEADWAQVARDVA
TRIDGAIAMAGEGKTGAAAGSIQDTYFDVFEASGMESRIGARDTAFKARLEAHFSKIAAL
INQGADQATLKAAAEAMAVDMKKAIEMLGGGSSSPTALFFYALLIILREGVEAMLIVTAI
LTYLVKTGNRDRQGTIVNSVLVALACSVVTAVLLKLVFRASAASQEVLEGATMLVAAVIL
FTMSYWLVSKAEAQKWMAYIKGKVEGSLSSGSLKALWFTSFLAVYREGAETVLFYQALTL
DADTTGLFAIAGGFAVGCVGLGVIYLVMRAGAMKLAIRPFFMITGGLLYAMAFIFAGKGI
MELVEGKIIEPTLVSWAPDLPMIGMFPYVESLVPQIALVVAAVIGLLVATRRRGPSPATP