Protein Info for Rru_A2808 in Rhodospirillum rubrum S1H

Annotation: periplasmic protein-probably involved in high-affinity Fe2+ transport (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF10634: Iron_transport" amino acids 26 to 173 (148 residues), 223.4 bits, see alignment E=7.5e-71

Best Hits

Swiss-Prot: 53% identical to Y885_BRUME: UPF0423 protein BMEII0885 (BMEII0885) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K07230, (no description) (inferred from 100% identity to rru:Rru_A2808)

MetaCyc: 53% identical to ferrous iron uptake system, iron-binding protein FtrA (Brucella abortus 2308)

Predicted SEED Role

"Periplasmic protein p19 involved in high-affinity Fe2+ transport" in subsystem Campylobacter Iron Metabolism or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQJ0 at UniProt or InterPro

Protein Sequence (176 amino acids)

>Rru_A2808 periplasmic protein-probably involved in high-affinity Fe2+ transport (NCBI) (Rhodospirillum rubrum S1H)
MKTLVSLAAAAALTLGVAASANAEEFQEFPIGEAKTINTLEVAAVYLKPIDMEPRGIDLP
ASQADIHLEADIHAAEANPNGFGAGEWVPYLTVSYRLENQDTGKVLTGNLMPMVAVDGPH
YGANIKMPGTGNYKLSYNIDPPSRQGFGRHTDKASGVGPWFQSFAVDYEFKYVPLK