Protein Info for Rru_A2805 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF214 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details transmembrane" amino acids 269 to 293 (25 residues), see Phobius details amino acids 313 to 338 (26 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details PF12704: MacB_PCD" amino acids 31 to 237 (207 residues), 43.3 bits, see alignment E=5.3e-15 PF02687: FtsX" amino acids 272 to 384 (113 residues), 66.5 bits, see alignment E=2.3e-22

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to rru:Rru_A2805)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQJ3 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Rru_A2805 Protein of unknown function DUF214 (NCBI) (Rhodospirillum rubrum S1H)
MVVVKQKGRWAMTLRLLVKSLLGPTSKIGVALASLAVGAAVVSALTSLYLDISIKMSEEL
RAFGANFMVAPLAGEAEAGAPPTVRGMATERLEAAIASVPADRLVGASPYLYGLVRLDLG
NAVMVGVDFPGLRRLSPYWQVEGSWIGVAFDDRNAMIGRRLAESMALKVGDGVTLLNRAE
GQQTRVTIKGIIDAGDQEDDQIFVALPLAQRLLGLAGRADFAMLSVVAQGPEADALAATM
TREFPDVSARPIRKISQSDGQILGKIDGLMALVAATILVITTLCVNATLTAMVARRTPEI
GLQKALGADNRAIVAQVLAETTLICLVGVVLGLVIGYGLAQVLGQAVFNAWVTFRPVVIP
LTLGVSLVAALIAAVLPVRGAVRVAPARVLRGE