Protein Info for Rru_A2791 in Rhodospirillum rubrum S1H

Annotation: DeoxyUTP pyrophosphatase subfamily 1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00576: dUTP diphosphatase
  • amino acids 19 to 145 (127 residues), 143.9 bits, E=1.4e-46
• PF00692: dUTPase
  • amino acids 20 to 145 (126 residues), 93.9 bits, E=3.2e-31

Best Hits

Swiss-Prot: 53% identical to DUT_DESPS: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from Desulfotalea psychrophila (strain LSv54 / DSM 12343)

KEGG orthology group: K01520, dUTP pyrophosphatase [EC: 3.6.1.23] (inferred from 100% identity to rru:Rru_A2791)

Predicted SEED Role

"Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.23)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (16/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (9/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (8/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (11/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (4/7 steps found)
• pyrimidine deoxyribonucleotides dephosphorylation (1/3 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.23

Sequence Analysis Tools

See Q2RQK7 at UniProt or InterPro

Protein Sequence (154 amino acids)

>Rru_A2791 DeoxyUTP pyrophosphatase subfamily 1 (NCBI) (Rhodospirillum rubrum S1H)
MLQITYLPHYDRATFGPVAYAKPGDAGFDLRAAIAAPITIEPGDITLVPAGIAMAVPEGY
EIQVRSRSGLSLKGLIVANAPGTVDSGYRGEFKVILTNIGRVAHTVAPGDRIAQAVLAAV
AHMPFVEVAELPPSERGSGGFGSTGVSVAETPRG