Protein Info for Rru_A2786 in Rhodospirillum rubrum S1H

Annotation: inner-membrane translocator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 61 to 80 (20 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 145 to 163 (19 residues), see Phobius details amino acids 196 to 213 (18 residues), see Phobius details amino acids 281 to 310 (30 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 59 to 336 (278 residues), 134 bits, see alignment E=2.8e-43

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to rru:Rru_A2786)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQL2 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Rru_A2786 inner-membrane translocator (NCBI) (Rhodospirillum rubrum S1H)
MRLERRESVPAWASVAAPLAAVAAALILCALLVAASGAPVLKAFATLFTGGFGSRFAIGE
TLTRATPLILTGLAAAVAFRAKLWNIGAEGQLYLGALAAVALGSGPLALPAWALLPVVML
GAALAGGLALLGPALLKTRFGVDEVVTTLLLNFIVLLFVSMMLEGPMKDPMAMGWPQSAA
MLPEAELPRLVARSRIHAGLLIAVALAGLVWLLKSRTIWGFEMRALGANPRAAAFAGVPV
GKVVLRVALLSGGLAGLAGACEVAGRAGYLTLDMSPGYGYSGIVIAMLAQLNPLGVIAAA
VMVAGVFVGADAMSRAVGVPNYIADVLVAVSLLCMLTAMLFTRYRLRRG