Protein Info for Rru_A2777 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF6, transmembrane (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 35 to 52 (18 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 270 to 287 (18 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details PF00892: EamA" amino acids 37 to 171 (135 residues), 43 bits, see alignment E=2.7e-15 amino acids 181 to 307 (127 residues), 51.5 bits, see alignment E=6.8e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2777)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQM1 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Rru_A2777 Protein of unknown function DUF6, transmembrane (NCBI) (Rhodospirillum rubrum S1H)
MASQPFAGSPAAPLPMPPAENLPPAAPPPGRAPQLRLGVACLVGATVIFAFQDGITKYLA
SHYPIPFIVMVRYWAFALFAIALVARKPGGVRAATRSKRPILQSLRALLLVSEIGLVALA
FRHMGLAEVQSIFAVYPLLVMAMAIVLLGERVGWRRWVATGVGFIGLLIIVRPGVGTFEP
AALYSLASATMYALYTVLTRMVSADDSAGTTFLYTGVVGAILVTLFGGAHWTAMSGIDWG
WMALLALFGMSSHFLLIKALEYAPASVLQPYNYLSLVWSGIVGYLVFNNIPDLATFIGGA
VIVASGLYVLYRDRKVKGLR