Protein Info for Rru_A2771 in Rhodospirillum rubrum S1H

Annotation: Histidinol dehydrogenase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 PF00815: Histidinol_dh" amino acids 24 to 429 (406 residues), 562.9 bits, see alignment E=2.3e-173 TIGR00069: histidinol dehydrogenase" amino acids 34 to 428 (395 residues), 533.6 bits, see alignment E=1.8e-164

Best Hits

Swiss-Prot: 100% identical to HISX_RHORT: Histidinol dehydrogenase (hisD) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00013, histidinol dehydrogenase [EC: 1.1.1.23] (inferred from 100% identity to rru:Rru_A2771)

Predicted SEED Role

"Histidinol dehydrogenase (EC 1.1.1.23)" in subsystem Histidine Biosynthesis (EC 1.1.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQM7 at UniProt or InterPro

Protein Sequence (434 amino acids)

>Rru_A2771 Histidinol dehydrogenase (NCBI) (Rhodospirillum rubrum S1H)
MPLRLEASSADFAPAFAALLAGKRESAQDVNDVVSAILADVRLRGDDALIDYTARFDKMT
VSAEGLRFSDDEVDTAVALIEPALRDALALAAKRITRFHERQMPTAISFTDEDGVRLGQR
WTAVSAAGLYVPGGLAAYPSSVLMNALPAKVAGVERLVMVVPTPAGRINPLVLAAAKLAG
VDEIYRVGGAQAVAALAYGTRTIAPVDKIVGPGNAYVAAAKRQVFGTVGIDMIAGPSEIL
VVADGANDPDWIALDLLSQAEHDAAAQSILITDDRAFADRVERAVTDRLRTLSRTEIASA
SWRDHGAIILVGDLLRDAPALVDKVAPEHLELAVADPDALAARVRHAGAIFLGRYTPEAI
GDYIAGPNHVLPTSRTARFSSGLGVLDFMKRTTLVGCGAESLGAIGPSAVRLARAEGLEA
HGLSVAARMNRGWE