Protein Info for Rru_A2761 in Rhodospirillum rubrum S1H

Annotation: Acyltransferase 3 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 48 to 70 (23 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 17 to 363 (347 residues), 91.3 bits, see alignment E=3.1e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2761)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQN7 at UniProt or InterPro

Protein Sequence (385 amino acids)

>Rru_A2761 Acyltransferase 3 (NCBI) (Rhodospirillum rubrum S1H)
MTYSVSATGDKSGVFLKSLTGIRLFAALAIVLHHVPGHFGISHELTEGWSLGQGVSVFFV
LSGFILTYRYPALTDRAAIVRFWVARVARIWPAHAFILFVLLLVNYDSMPDIESTSLKNI
LANVFLVQSWFPYAGYFFGYNSVSWSISTEMGFYLLFPFLIFCFQKTWLLKVFISFSVGF
VFVLLAYYMSIPSFQYPDNKIVMEGLIYVNPLARLFEFVAGMCSAFLWIKFHNRIVMNRV
LWTVLEVFSVLFLIFNVSFLSKIFSVFSFDFGFPGLYWKVMSLFPALAAAVFIFVMAKSE
GFLSSVLSTRFFVYMGEVSFSIYLLHLVIIKMFDDLPALGYLNDFFALILALISVFVCSM
LMFHFVEKPGKTMIISVSRLFGNRK