Protein Info for Rru_A2731 in Rhodospirillum rubrum S1H

Annotation: Exopolysaccharide synthesis, ExoD (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 43 to 58 (16 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details PF06055: ExoD" amino acids 16 to 194 (179 residues), 139.2 bits, see alignment E=4.9e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2731)

Predicted SEED Role

"Exopolysaccharide synthesis, ExoD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQR7 at UniProt or InterPro

Protein Sequence (214 amino acids)

>Rru_A2731 Exopolysaccharide synthesis, ExoD (NCBI) (Rhodospirillum rubrum S1H)
MPHPLPRTTPAPSAARTLAGLRRLPGARGPTLGAVADHLSDRAIPLLLLFLGLAAFVPTP
GLPVGMITGSACAVVAFAALIRPGESRPALPGWLSRKPLPRRVLHGVLRRAVPLLRWLER
RLRPRLSGLALGAGLGLAYGMVVVHAALVALPIPFGNTLPALAIILIALGILARDGLMVL
VGHGVGLAWIAILAGVGRWLAGALAGEPAATFGQ