Protein Info for Rru_A2715 in Rhodospirillum rubrum S1H

Annotation: Acyltransferase 3 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 47 to 70 (24 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 11 to 337 (327 residues), 96.9 bits, see alignment E=6.3e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2715)

Predicted SEED Role

"Acyltransferase 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQT3 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Rru_A2715 Acyltransferase 3 (NCBI) (Rhodospirillum rubrum S1H)
MRSSTGQHSLALDHIRALAAFLVFAWHFAHAGDPGYPVPFDAPSPWILAIFDAGHTGVAL
FMTLSGYLFAKILEGRSFSYPIFLLNRALRLLPLLVLVIIVIGIRKYWIGADLDAYWNNI
LWGPLLPTLPNGGWSITVEAHFYLLLPLLLWLSARWRFALPLLLVATVGLRLGLYCAKGE
VQFLAYWTLVGRIDQFVLGIIAARSQGWLMRHPLVIGGLVASLLAFYAVFDAAGGFALHP
SHPSSSPVWIILPTFEGMVYAAAIAWYDRSGLAGKGLVSKGLARIGDYSYSLYLLHFFVV
FRMADFIHRHIMDISTPRAALPWAVVCFVLMIPLGYLSFRFIEAPFLSLRRNYIEPRLKK
AYGASPS