Protein Info for Rru_A2707 in Rhodospirillum rubrum S1H

Annotation: Alpha/beta hydrolase fold (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF00561: Abhydrolase_1" amino acids 14 to 127 (114 residues), 85.4 bits, see alignment E=1.5e-27 PF00975: Thioesterase" amino acids 15 to 100 (86 residues), 35.3 bits, see alignment E=4.5e-12 PF12697: Abhydrolase_6" amino acids 16 to 252 (237 residues), 102.6 bits, see alignment E=1.5e-32 PF12146: Hydrolase_4" amino acids 16 to 117 (102 residues), 41.2 bits, see alignment E=3.9e-14 PF00756: Esterase" amino acids 48 to 107 (60 residues), 23.8 bits, see alignment E=1.1e-08

Best Hits

KEGG orthology group: K01175, [EC: 3.1.-.-] (inferred from 100% identity to rru:Rru_A2707)

Predicted SEED Role

"putative esterase/lipase YbfF"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQU1 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Rru_A2707 Alpha/beta hydrolase fold (NCBI) (Rhodospirillum rubrum S1H)
MTVDLAAQCLGEGPPLVVLHGLFGSARNWAGIARRLGDRYRVHALDLRNHGESPWTEALD
YPLMAGDVAAYIEREIGDGPAPVVVGHSMGGKVAMTLALLHPGRVGALVVADIAPVAYRP
GLDAFAEAMLAVPLAGLARRSQVEALLADSIPSPGIRRFLAQNIVEDPAGGLRWRLNLEG
LRREMATLAGFPAFPADRTFSGRTLVVRGALSDYVGEAERPAFERLFPGYRLATLKGAGH
WLHSEKPEAFVDILRGFLGAPAAP