Protein Info for Rru_A2701 in Rhodospirillum rubrum S1H

Annotation: SecE subunit of protein translocation complex (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 65 transmembrane" amino acids 29 to 53 (25 residues), see Phobius details PF00584: SecE" amino acids 8 to 61 (54 residues), 71.8 bits, see alignment E=1.7e-24 TIGR00964: preprotein translocase, SecE subunit" amino acids 8 to 62 (55 residues), 61.3 bits, see alignment E=3.2e-21

Best Hits

Swiss-Prot: 37% identical to SECE_THEMA: Protein translocase subunit SecE (secE) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K03073, preprotein translocase subunit SecE (inferred from 100% identity to rru:Rru_A2701)

Predicted SEED Role

"Preprotein translocase subunit SecE (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQU7 at UniProt or InterPro

Protein Sequence (65 amino acids)

>Rru_A2701 SecE subunit of protein translocation complex (NCBI) (Rhodospirillum rubrum S1H)
MPRTNPGQFVRQVRQEIGKVTWPSRKETVISTVMVFIMASLAAVFFLLVDWILAEGVQFI
FGLGG