Protein Info for Rru_A2680 in Rhodospirillum rubrum S1H

Annotation: Ribosomal protein L29 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 68 PF00831: Ribosomal_L29" amino acids 6 to 61 (56 residues), 81.6 bits, see alignment E=1.6e-27 TIGR00012: ribosomal protein uL29" amino acids 8 to 58 (51 residues), 71.5 bits, see alignment E=2.2e-24

Best Hits

Swiss-Prot: 100% identical to RL29_RHORT: 50S ribosomal protein L29 (rpmC) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K02904, large subunit ribosomal protein L29 (inferred from 100% identity to rru:Rru_A2680)

MetaCyc: 47% identical to 50S ribosomal subunit protein L29 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L29p (L35e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQW8 at UniProt or InterPro

Protein Sequence (68 amino acids)

>Rru_A2680 Ribosomal protein L29 (NCBI) (Rhodospirillum rubrum S1H)
MSAAEDTRSKTDDQLKDSLLELKKEQFNLRFQAASGQLENTARVRTVRREIARIKSVRGE
RNRAPQAK