Protein Info for Rru_A2667 in Rhodospirillum rubrum S1H

Annotation: Adenylate kinase, subfamily (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01351: adenylate kinase
  • amino acids 5 to 138 (134 residues), 170.7 bits, E=1.7e-54
• PF13238: AAA_18
  • amino acids 6 to 135 (130 residues), 29.7 bits, E=1.3e-10
• PF00406: ADK
  • amino acids 9 to 170 (162 residues), 192.5 bits, E=7.1e-61
• PF13207: AAA_17
  • amino acids 9 to 149 (141 residues), 96.9 bits, E=2e-31

Best Hits

Swiss-Prot: 59% identical to KAD_CHESB: Adenylate kinase (adk) from Chelativorans sp. (strain BNC1)

KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 100% identity to rru:Rru_A2667)

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• purine deoxyribonucleosides salvage (4/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.3

Sequence Analysis Tools

See Q2RQY1 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Rru_A2667 Adenylate kinase, subfamily (NCBI) (Rhodospirillum rubrum S1H)
MTGKRVIFMGPPGGGKGTQAQRLEKKYQLKQLSTGDMLRAAVAAGTDLGRQAKAIIDAGK
LVSDDIMVGMIAERIDETDCANGFVLDGFPRTVPQAEALDVMLADKGLKLDAVIELRVDD
SILFDRIRKRAAEADAGSVRADDNEDTLRKRLDIYHGMTAPILPYYGQKGLLHVVDGTLP
VDAVTRELEGILGDC