Protein Info for Rru_A2667 in Rhodospirillum rubrum S1H

Annotation: Adenylate kinase, subfamily (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 TIGR01351: adenylate kinase" amino acids 5 to 138 (134 residues), 170.7 bits, see alignment E=1.7e-54 PF13238: AAA_18" amino acids 6 to 135 (130 residues), 30.5 bits, see alignment E=6.9e-11 PF00406: ADK" amino acids 9 to 170 (162 residues), 192.5 bits, see alignment E=7.1e-61 PF13207: AAA_17" amino acids 9 to 149 (141 residues), 98.6 bits, see alignment E=5.6e-32

Best Hits

Swiss-Prot: 59% identical to KAD_CHESB: Adenylate kinase (adk) from Chelativorans sp. (strain BNC1)

KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 100% identity to rru:Rru_A2667)

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQY1 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Rru_A2667 Adenylate kinase, subfamily (NCBI) (Rhodospirillum rubrum S1H)
MTGKRVIFMGPPGGGKGTQAQRLEKKYQLKQLSTGDMLRAAVAAGTDLGRQAKAIIDAGK
LVSDDIMVGMIAERIDETDCANGFVLDGFPRTVPQAEALDVMLADKGLKLDAVIELRVDD
SILFDRIRKRAAEADAGSVRADDNEDTLRKRLDIYHGMTAPILPYYGQKGLLHVVDGTLP
VDAVTRELEGILGDC