Protein Info for Rru_A2667 in Rhodospirillum rubrum S1H
Annotation: Adenylate kinase, subfamily (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 59% identical to KAD_CHESB: Adenylate kinase (adk) from Chelativorans sp. (strain BNC1)
KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 100% identity to rru:Rru_A2667)Predicted SEED Role
"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
- superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
- superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
- superpathway of purine nucleotide salvage (13/14 steps found)
- superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
- superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
- adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
- purine deoxyribonucleosides salvage (4/6 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.4.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RQY1 at UniProt or InterPro
Protein Sequence (195 amino acids)
>Rru_A2667 Adenylate kinase, subfamily (NCBI) (Rhodospirillum rubrum S1H) MTGKRVIFMGPPGGGKGTQAQRLEKKYQLKQLSTGDMLRAAVAAGTDLGRQAKAIIDAGK LVSDDIMVGMIAERIDETDCANGFVLDGFPRTVPQAEALDVMLADKGLKLDAVIELRVDD SILFDRIRKRAAEADAGSVRADDNEDTLRKRLDIYHGMTAPILPYYGQKGLLHVVDGTLP VDAVTRELEGILGDC