Protein Info for Rru_A2628 in Rhodospirillum rubrum S1H

Annotation: Cation efflux protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 17 to 294 (278 residues), 221.5 bits, see alignment E=6.9e-70 PF01545: Cation_efflux" amino acids 22 to 214 (193 residues), 136.8 bits, see alignment E=8.7e-44 PF16916: ZT_dimer" amino acids 218 to 295 (78 residues), 84.3 bits, see alignment E=5.3e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2628)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RR20 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Rru_A2628 Cation efflux protein (NCBI) (Rhodospirillum rubrum S1H)
MGTQRSDTRDQSARLMRRATYASVTVAMTLVVAKLVAWVLTDSVALLSTLIDSLIDVGAS
LVTLLAVREALTPADEEHRFGHGKAEPLAGLGQAAFIAGSGIFLVIEAAGRLTAPLPVQR
GEIGIAVMVFSILATIGLVAYQRRVIAQTKSVAISADSLHYAGDLLINLSVIVSLGLAMT
VDLPILDPLFAIAIALWLMKNAWTIGANSVNLLMDRELPPEDRVRIIKLALENPRVFDIH
DLRTRSSGPQTFIQLNVELDGEMTLSASHAIVTEIENRLRAAFPGAEVLIHQDPAGIQED
HHPDFAYEDTSALLEADAASQPRRL