Protein Info for Rru_A2624 in Rhodospirillum rubrum S1H

Annotation: Short-chain dehydrogenase/reductase SDR (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF13561: adh_short_C2" amino acids 17 to 256 (240 residues), 304.8 bits, see alignment E=6.5e-95 PF00106: adh_short" amino acids 20 to 200 (181 residues), 71.1 bits, see alignment E=1.3e-23 PF23441: SDR" amino acids 67 to 257 (191 residues), 29.1 bits, see alignment E=1e-10

Best Hits

Swiss-Prot: 71% identical to FABI1_RHIME: Enoyl-[acyl-carrier-protein] reductase [NADH] 1 (fabI1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00208, enoyl-[acyl-carrier protein] reductase I [EC: 1.3.1.9] (inferred from 100% identity to rru:Rru_A2624)

MetaCyc: 62% identical to enoyl-(acyl-carrier-protein) reductase [NADH] (Agrobacterium fabrum C58)
Enoyl-[acyl-carrier-protein] reductase (NADH). [EC: 1.3.1.9]

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.3.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.9

Use Curated BLAST to search for 1.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RR24 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Rru_A2624 Short-chain dehydrogenase/reductase SDR (NCBI) (Rhodospirillum rubrum S1H)
MPNSTALLAGKKGLVLGVANDRSIAWGIAKAASDAGASIAFTYQGDPLLKRVKPLVEGLS
ERHLLMPCDVTDEASLDAVFATLKETWGTIDFVVHAVAFSDKDQLKGHYMHTTRENFQQT
MLISVFSFTDIARRASEIMNDGGAMITLTYYGAERVMPHYNVMGVAKAALEASVRYLAAD
LGGRGIRVNAISAGPIKTLAASGIGDFRYILKWNEYNSPLRRNVTIDEVGNSGLYLLSDL
SRGVTGEVHHVDSGYHLVGMLNMDSVSEVSALLATVKKD