Protein Info for Rru_A2594 in Rhodospirillum rubrum S1H

Annotation: Putative diguanylate cyclase (GGDEF domain) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 174 to 192 (19 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details amino acids 326 to 344 (19 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 34 to 158 (125 residues), 80 bits, see alignment E=1.6e-26 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 409 to 574 (166 residues), 170.5 bits, see alignment E=1.3e-54 PF00990: GGDEF" amino acids 413 to 570 (158 residues), 140.2 bits, see alignment E=5.3e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2594)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RR54 at UniProt or InterPro

Protein Sequence (582 amino acids)

>Rru_A2594 Putative diguanylate cyclase (GGDEF domain) (NCBI) (Rhodospirillum rubrum S1H)
MLALTRLLLLVLVVACATPAFAEERGADHILARAFLEDPAGVLTIDEVARGDFTPFGPNF
SKGYTQSVYWVRLLVRASAAPEKTVLFIRPSFLNEVRLFYRDRASPDGWATRVSGNRYPF
SERDRKSVALGFVVDVTHPQEEFYLRIKTNTQMQIDVQAVSPDVAADTDSRRDMVMVFFV
TSMILMIFWGVNEYSFDRYRIFALFCIHQLAFTLFGISAVGYFSPFWVMIFPGIVDRAFY
FLYMSISFTLILFCRELFKPYQPHPVLAKGLDLARWAFPLQIIALIAGYDALAVISNALL
IKGALFYFVFVAFSLKVDLDPTRRTLRIFFIGIALINLIFWMTPRVGGELKWLGLSAVQA
LVIDGFVMGILFAWLAHGRGRQVREDAQRKIRLVKESYLAERDLKARAEREARVDYLTGV
LNRRSFFELAEGELARSIRFGRPLAVLMIDIDYFKAVNDTWGHGVGDEVLQNVAGLIGQT
LRGADIFGRTGGEEFTAVIVEASGSEALEVAQRLCAVVAQGKIVGPGGEAIGVTLSIGVS
LLRGRDMAFEILSREADQAMYGAKRAGRNRVVVHRDAWGALG