Protein Info for Rru_A2562 in Rhodospirillum rubrum S1H

Annotation: CheW protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF01584: CheW" amino acids 30 to 162 (133 residues), 103.9 bits, see alignment E=2.9e-34

Best Hits

KEGG orthology group: K03408, purine-binding chemotaxis protein CheW (inferred from 100% identity to rru:Rru_A2562)

Predicted SEED Role

"Positive regulator of CheA protein activity (CheW)" in subsystem Bacterial Chemotaxis or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RR83 at UniProt or InterPro

Protein Sequence (167 amino acids)

>Rru_A2562 CheW protein (NCBI) (Rhodospirillum rubrum S1H)
MNQLTAAGDSRSLTTVKGANALSTVDEQVFVTIYVEKQLFGIPVERVQDILIPEKIARIP
LAPPEVAGAINLRGRIVTVIEVRKRLGLKAKKTGGPVMCVTVELGNELYSLMVDSVGNVQ
TLPVARIEANPTTLDPRWRAISRGVVRLDGELLVVLDVDTFLTFGTN