Protein Info for Rru_A2561 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 50 to 68 (19 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 119 to 143 (25 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 332 to 351 (20 residues), see Phobius details amino acids 365 to 397 (33 residues), see Phobius details amino acids 411 to 437 (27 residues), see Phobius details amino acids 456 to 476 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2561)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RR84 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Rru_A2561 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MIPVAGVSLLTATVLTLAVSLGAPASLTWGTGLALALYILSVWGRMRRAARFYILAAIAA
SALAAAVGKLDPEALRRAIAAMGFVATLFVSFGVLREAALTSPLVRRCGRFLAHRPPGWR
YLALTLGGHLFGMILNFGVIPLLGTMVTEGTRAADHPEEDADQARRATVRRLRMTQAIHR
GFAATLTWSPLTVSLAVILTALPSLSWSAAAPAMLAAAAGFVAIGWVMDRFSRARLRVAP
PPASPEEEQGSWALVLPVLALVGAILGVGWLMEEVFGIRLVIGVMLFVPLLAAAWIVLQD
SAVLGFGLALSDTATRLGHYVRDTLPAYNGELAIVGSASFIGGVVTGLLHADAVPGLLAG
IGLPSWALMAIVPWLAIAFGQIGMSPVLAISLLAAAIPSPESLGLPAPVMAVTYSGSWAL
MAASSPFTAAVALSARVATAPGRPVGAAAFGARDNGGFTVVCALALSLYVIALTRLMA