Protein Info for Rru_A2544 in Rhodospirillum rubrum S1H

Annotation: Signal Transduction Histidine Kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 TIGR00229: PAS domain S-box protein" amino acids 50 to 166 (117 residues), 26.6 bits, see alignment E=2.8e-10 PF13188: PAS_8" amino acids 51 to 102 (52 residues), 24.9 bits, see alignment 4.4e-09 PF00989: PAS" amino acids 52 to 144 (93 residues), 32.2 bits, see alignment E=2.8e-11 PF08448: PAS_4" amino acids 58 to 163 (106 residues), 39.4 bits, see alignment E=1.8e-13 PF13426: PAS_9" amino acids 66 to 160 (95 residues), 18.5 bits, see alignment E=6.3e-07 amino acids 183 to 286 (104 residues), 11.8 bits, see alignment E=7.6e-05 PF07568: HisKA_2" amino acids 300 to 361 (62 residues), 24.2 bits, see alignment E=8.9e-09 PF07536: HWE_HK" amino acids 300 to 380 (81 residues), 82.6 bits, see alignment E=8.6e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2544)

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRA1 at UniProt or InterPro

Protein Sequence (489 amino acids)

>Rru_A2544 Signal Transduction Histidine Kinase (NCBI) (Rhodospirillum rubrum S1H)
MNDPVVLSELRRRLAEAEETLNAIREGEVDALVIGEGGVDEVFAIGGDTESYRTFMEAMD
TGAAAVDEDGRVLYANSALCRLIDHPLPTLQGKPLVSFFDARAAAEIGQMVGKTANQREK
VEISLKDAATKMAQVFLVSAKPVRLGLVQGHAVTFTDLTERVRSETAERAERIAAAIIAS
ANEIVVVCDRVGMITHANSAASAIYDGDLIGKMFEDAIPLTFTDAPDLMSGGALIDLALN
GQARQGIEAIATRAPKVKDYLISAAPLQVTEDQISGCVLTMVDLSQRKAAEHQQLLLMRE
LDHRVRNTLALVLSISNRTLSNEDTLQGFHQAFTQRIHGLAATHSLLAKQGWTKLSLHDI
VRAELAPYVETDGTRLRLEGGEVALIPRAAIALGLIFHELATNAVKYGALSREGGHVLVA
VRGPTADGAAMRVDWVESGGPMVSPPQRKGFGHTVISHSLAYSSKGGTDLSFPPEGVICA
LRIPMEDIP