Protein Info for Rru_A2517 in Rhodospirillum rubrum S1H

Annotation: AMP-dependent synthetase and ligase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 60 to 76 (17 residues), see Phobius details amino acids 181 to 192 (12 residues), see Phobius details PF00501: AMP-binding" amino acids 115 to 325 (211 residues), 129.6 bits, see alignment E=1.4e-41 PF13193: AMP-binding_C" amino acids 375 to 443 (69 residues), 29.6 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2517)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRC8 at UniProt or InterPro

Protein Sequence (459 amino acids)

>Rru_A2517 AMP-dependent synthetase and ligase (NCBI) (Rhodospirillum rubrum S1H)
MTSPSKTPNLFAPLAEIDAERPALISEEGLLTHGALRRRVGAVQRWLADQPAERPLLLSA
TAASDLLPAFIAAGALGRTAAVGDRRWSEAVRARVVAALGQPLIGESLPAFPTGEAADDP
PRFAPNPSRPFYVGFTSGTTGLPKAYARSHRSWIETMVAGRDGFALDAADRILVLGPLVH
SLALYGALQALWLGGAAIVDGMGGWGVDQGATVVIGVPPLLAALARTGPHSAIRTVLSSG
QALDPTTEAVLRRGFPKAVLVDFYGTSEQSFIAWRAVGEEATRGTVGRPFAGVEAEIRDA
EGRPVAPGVQGRLHVKSPMVFDGYLEGLDRGGFSSKDGWSSVGDLGWLGEDGTLTLAGRE
GGMVVVRGVNVFPQEVEAALKALPGILDAGVVGLPDAGRGALLVALVEGEGVVDPAALGA
LRPEKRPRRIIGVSALPRTLTGKIDRRALAELAAGLIAR